PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00040.1_g00041.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 189aa    MW: 21802.9 Da    PI: 6.514
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00040.1_g00041.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.84.8e-1372122555
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                              +++rr+ +NRe+ArrsR RK+  ++eL   v+ L +eN++  ++l++ ++ 
  Rsa1.0_00040.1_g00041.1  72 RKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENQQILERLNQASDS 122
                              689************************************999999887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.8E-1268132IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.55370133IPR004827Basic-leucine zipper domain
PfamPF001703.4E-1172130IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.82E-1272121No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-972144No hitNo description
CDDcd147023.58E-1773120No hitNo description
PROSITE patternPS0003607590IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MQPNYDSSSL NNMQQQDYFH IHHYYNNLNP SNNNLNLIPY PQIQELNLQS PASNHSATSD  60
EATEDIFVIN ERKQRRMVSN RESARRSRMR KQRHLDELLS QVAWLRSENQ QILERLNQAS  120
DSNDLVLQEN SSLKEENLAL HQVITSMKKV IGAGGSRSIN GRYSSSSLDN DLDQDLSSIT  180
DDRRTHHPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18491RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2401010.0AC240101.1 Sisymbrium irio clone SIR-39M12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013720907.11e-106PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC24e-29BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A078GMN71e-106A0A078GMN7_BRANA; BnaC09g42010D protein
STRINGBra023540.1-P1e-104(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM106321532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15830.11e-76basic leucine-zipper 3